McDonnell Genome Institute

Washington University

CircRNA

chr2|61876919|61880394|-|CCT4|ENST00000394440.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

TDLVELSK

Amino Acids from 5' Exons

WDNLVGGRAGSHPKSVKFWHNQSKGQDWAYSVLLICSQNR,GTIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKTD,GQLMTVSWWKGWFSPKKCQILAPELKRPRLGLFSFAYLLPKQ

Amino Acids from 3' Exons

LVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQK,WWSCLRLKIKQEMAPHQSSLLAPSILVPSFFRK,GGAVGSRYRSRRWHHISSHHCWLPLRFLYQASSE