McDonnell Genome Institute

Washington University

CircRNA

chr2|61496878|61522683|-|XPO1|ENST00000401558.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9996

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

QYYGLQILENVIK

Amino Acids from 5' Exons

FLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQ,SMFQCFEMSLSASLRLLVVANMKNNLHYLLQCNS,PECSNVSKCLSEVPHDCWCECKPIRTICNTIYSDNDATKA

Amino Acids from 3' Exons

YYGLQILENVIKTRWKILPRNQCE,TMDYKFWKMKQGGRFFQGTSAK,LWTTNFGKCDKNKVEDSSKEPVR