McDonnell Genome Institute

Washington University

CircRNA

chr2|61248510|61278443|-|USP34|ENST00000398571.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9927

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

SERKEDNAPR

Amino Acids from 5' Exons

GMFEIASHFEFQYYEIHIYGHDDERESEYTLFLPITFGHDALYRRFSYGKEEER,ACFKKLPRILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTEDFLMGKSERKE,HVLRNCLAFVSILDTHLIWSRKRKIHTFPSHYVWTRPIQKIFLWERVRGKK

Amino Acids from 3' Exons

TTLLDLDALARHLADCIR,QRSSTMPWQDIWLTVFE,NAPRLRCLGKTFGLYSK