McDonnell Genome Institute

Washington University

CircRNA

chr2|61241559|61350693|-|USP34|ENST00000398571.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9527

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

FDVSSELLELK

Amino Acids from 5' Exons

THSAYMLFYKRMEPEEENGREYKFDVSSELLE,HTVHICCFTNAWNQRKKMAENTNLMFRQSY,TQCIYAVLQTHGTRGRKWQRIQICFVRVTR

Amino Acids from 3' Exons

LKHCSRYIHDLFPSLIKNLDPVPLRHLLNLVSALEPSVHTEQ,NIVVGIYMTYFLHSSRIWIPYHLDIYLIWSQLLSQVFILN,ETLSVYTLISFTHQEFGSRTTTSTSGLSSAKCSYT