McDonnell Genome Institute

Washington University

CircRNA

chr2|60779636|60782770|+|PAPOLG|ENST00000238714.7

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.995

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

23

2

Peptide

SIGRGIYSNMLGFLGGVSWAMLVAR

Amino Acids from 5' Exons

DVVFIPTCDSLVVSPGQCLQELANCIQMQQHLLFISSFFFPS,TWYLFQHARIPWWCLLGNASCKNLPIVSKCSSIYFSSVLFSFFQV,RGIYSNMLGFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSK

Amino Acids from 3' Exons

VLQSQMKFFKESQIGPNYLSHRISFKSI,SCSHRNSSRKVRLVQTTATEFLSKV,LAVTDEILQGKSDWSKLLEPPNFFQKY