McDonnell Genome Institute

Washington University

CircRNA

chr2|58048826|58048967|+|VRK2|ENST00000340157.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9661

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

11

Peptide

IGSGGFGLIYLEVMPPK

Amino Acids from 5' Exons

KCHQKEMKNTNFLFHFQKARFWMIWKAISGYWARRLALEDLDYI,SDATKKKKIQTSYSISRRQGSGYGRQSVGTGQEDWLWRIWIDIF,VMPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYL

Amino Acids from 3' Exons

KCHQKEMKNTNFLFHFQKARFWMIWKAISGYWARRLALEDLDYI,SDATKKKKIQTSYSISRRQGSGYGRQSVGTGQEDWLWRIWIDIF,VMPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYL