McDonnell Genome Institute

Washington University

CircRNA

chr2|55667861|55673079|-|PNPT1|ENST00000260604.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

19

Peptide

NTKVMLEASAENILQQDFCHAIK

Amino Acids from 5' Exons

KNFQKPIHMKNPSMLLQRKFLEVLFMNTK,KISRSRSINNRILQCCCKGSFKYCFEIQK,KFPEADPYEIIESFNVVAKEVFRSIVLNEYK

Amino Acids from 3' Exons

SCWKPLQRTFYSRTFAMLSKWENIPNKFRAFSSWKKLVLPRGHLRSYLPLRQRLNILI,HVGSLCREHFTAGLLPCYQSGSEIYPTNNSGHSAVGKRNWCYQEDTSEVIYPFARDCEIYS,MLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKETGVTKRTPQKLFTPSPEIVKYTH