top of page

McDonnell Genome Institute

Washington University

CircRNA

chr2|55564312|55615506|-|SMEK2|ENST00000611717.4

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9951

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

KGSLLLESK

Amino Acids from 5' Exons

CTIYIAQISQRCKSLGRGRNVVRRRGRKSSCGTSGKTARRFSRLKVYGDK,VPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKK,YHLYCVVTDFAEMQKPWKRMKKCGLMKMKKRKEKQLWHQWKNLSQKMIFQIIMKSLWRLKK

Amino Acids from 3' Exons

DHYSWNQRIQILHIRNN,ITTLGIKDKSKYCISETT,SLLLESKINPNTAYQKQQ

bottom of page