McDonnell Genome Institute

Washington University

CircRNA

chr2|55343647|55344514|-|CCDC88A|ENST00000263630.12

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9212

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

TSELSEGIK

Amino Acids from 5' Exons

ERDMDRKKIEELMEENMTLEMAQKQSMDESLHLGWELEQISRTSELSE,NEIWIEKRLKNWKKILWKWHRNKVWMNHYILAGNWNRYPELVNFPK,TRYGKKDRINGRKYDFGNGTETKYGIITSWLGTGTDIQNTFR

Amino Acids from 3' Exons

ELKEDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEM,NKKTIKFYKQKPCWKTNRELVLVLINYMNKKRTYNKLNFMIWK,IKRRQSSFIRNKNHVGRPTRGNSCSFITIRKRELTTESTSYGN