McDonnell Genome Institute

Washington University

CircRNA

chr2|54649614|54649989|+|SPTBN1|ENST00000333896.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.95

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

15

Peptide

MHTTFEHDIQALGTQMLQER

Amino Acids from 5' Exons

MLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQ,CYKNDSGSLPETPGTLGRSAWTRSITWQMSSSTLDIQMPPPSLNGRMASMKPGPTSWSSLTQEHRFLPLPMNCTSFTTMPRRSLGVYRTNTRNSLRSLGEIRTQWRPYRECTLHLSMTSRLWAH,VTRTIPGVCPRHREHWAGARGHGQSPGRAHQLWTFRCRHHRMEGWPQSLGRPPGAHHKNTDSCRFLTAQVLPRCQGDLWAYTGQTQETPGAWERSEHSGDLTENAHYIAHPGSGHT

Amino Acids from 3' Exons

MLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQ,CYKNDSGSLPETPGTLGRSAWTRSITWQMSSSTLDIQMPPPSLNGRMASMKPGPTSWSSLTQEHRFLPLPMNCTSFTTMPRRSLGVYRTNTRNSLRSLGEIRTQWRPYRECTLHLSMTSRLWAH,VTRTIPGVCPRHREHWAGARGHGQSPGRAHQLWTFRCRHHRMEGWPQSLGRPPGAHHKNTDSCRFLTAQVLPRCQGDLWAYTGQTQETPGAWERSEHSGDLTENAHYIAHPGSGHT