McDonnell Genome Institute

Washington University

CircRNA

chr2|53895006|53900017|-|PSME4|ENST00000389993.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9746

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

EDMTEIPK

Amino Acids from 5' Exons

EYGCLCWCGRAAAWQKQGGYDR,NMVVYAGVEEQPKLGRSREDMTE,IWLFMLVWKSSLSLAEAGRIQ

Amino Acids from 3' Exons

IPKSCVEIAELLQQSKNPSINQILLSPEKIKEGIKRQQEKNADAL,FQSHVLKRNYFNSQKTPLSTRYCLAQKKLRKELNANRKRMPMP,SKVMCNSGITSTVKKPLYQPDIAPRKNGRNTPTGKECRCPK