McDonnell Genome Institute

Washington University

CircRNA

chr2|53885689|53895736|-|PSME4|ENST00000389993.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.907

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

24

Peptide

TTSASTFVFQGGCPKPTQIIAGDRPDNHWLHYDSK

Amino Acids from 5' Exons

YNGWQVQEDPFLQQLQNNFSFYLCFS,IEMADGKCRKILFYSSYRTTSASTFVFQ,LKWLMASAGRSFSTAVTEQLQLLPLFFK

Amino Acids from 3' Exons

VDALNPPKLLLVIGLIIIGCIMTAKLYQELKKNGSQVALWKKLTGDTTPGQ,WMPTHPNYCWASLVALQQNYTKNKRMGVKLLCGKNSLGILHLAK,GCPKPTQIIAGDRPDNHWLHYDSKTIPRTKKEWESSCFVEKTHWGYYTWP