McDonnell Genome Institute

Washington University

CircRNA

chr2|50506494|50538636|-|NRXN1|ENST00000331040.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9989

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

TGTISVNTLR

Amino Acids from 5' Exons

AKVPRLFLLAITSMITSGTQCVFGVEKVSQWMTNRPQ,QRSRDSFCWLPQRVAHSACSSAWKKFKVNSGPTGHD,KGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMT

Amino Acids from 3' Exons

VPFLSTRCVLPTLLLVRVRFWTWMMSCTWGGCQKIKLALSSPPRCGLLCSTMATWAASGICSSMAKAKISGKWLKFKVLLESLPAQRKQQNRALATLAKTMACAGMGGTDMSVIVPEQAILAGPVRE,YHFCQHVAYSLHCSWEDSGPGVVPGGAARKSWPCLPHRGVDCSAQLWLRGLHQGFVHRWPKQRYPANGSSKYCWSEAFLLKGNSKTVPQPLQKQWHVQGWVEQICLLFRNRLSWQVLE,TISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCER