McDonnell Genome Institute

Washington University

CircRNA

chr2|50053270|50538636|-|NRXN1|ENST00000401669.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9956

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LALSSPPR

Amino Acids from 5' Exons

GVSSQSSIAKQPLAGKSRASPSRASSLGCTTMAKFIWQPKTMPTSPWEMDWLVKCLPLQLSQQPLPCNQRCPHQLWRLPRPWLLAQPEEESPRQKNPLA,ASAHNLQPSNHNNWRERAGPALPGPALWAVLQWLESSEYGSRKRCQHRHSGKCETGWSAFLYDNVNSHCHAIRDVHINYGDYHDPGYHSQKRKAPDKRTHP,RQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQ

Amino Acids from 3' Exons

VPFLSTRCVLPTLLLVRVRFWTWMMSCTWGGCQKIKLALSSPPRCGLLCSTMATWAASGICSSMAKAKISGKWLKFKVLLESLPAQRKQQNRALATLAKTMACAGMGGTDMSVIVPEQAILAGPVRE,YHFCQHVAYSLHCSWEDSGPGVVPGGAARKSWPCLPHRGVDCSAQLWLRGLHQGFVHRWPKQRYPANGSSKYCWSEAFLLKGNSKTVPQPLQKQWHVQGWVEQICLLFRNRLSWQVLE,TISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSKETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCER