McDonnell Genome Institute

Washington University

CircRNA

chr2|48454594|48498735|+|PPP1R21|ENST00000281394.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.911

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

11

Peptide

AVLEPIQSTSLEQLK

Amino Acids from 5' Exons

EQLKMKDQSLRKLQQEMDSLTFRNLQLAKRVELLQDELALSEPRGKKNK,SNKRISHENYNRKWTVHFEICSLPRGNYFKMNLVNHEARKT,ATENEGSVIEKTTTGNGQFDISKSAACQEGRTTSRTSSKTTRQEKQ

Amino Acids from 3' Exons

VQQSLEKISKLEQEKEHWMLEAQLAKIKLEKENQRIADKLKNTGSAQLVGLAQENAAVSNTAGQDEATAKAVLEPIQSTSL,FNRVWKRFLNWSRKKNIGCWKHNPKSSRKKTSELQISRIQVVPSWLGWPRKMLLCQILLARMKPQLRLCWSPFRAPV,STEFGKDFTGAGKRTLDVGSTISQNQARERKPANCRAEEYRCPAGWAGPGKCCCVKYCWPGSHSGCVGAHSEHQS