McDonnell Genome Institute

Washington University

CircRNA

chr2|47373462|47374048|+|EPCAM|ENST00000474691.1

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SVIFQFGIK

Amino Acids from 5' Exons

NVSVKTTSWPTALIIIVNASVLQLVHKILSFAQSVSKISLPVSFILTYFFNCALSWKEFYWLKSESCYKVSVGTHKFQIIFDPGTLELIFFFPSNQLFFSLALRFLFQWLPNVWRQKMAQNLGEEQNLKGPSRTMMGFMILTAMRAGSLRPSSATAPPCAGVTLLGSEEQTRTLKPALSEEP,MCLKLQAGRKLLCESSMPVYFSWCTKYCHLLKAVKYPNYLALFLNTSLIDVPVGKSFIGLNLNHVTKVWEHINFKSLTLELSFFFSRNHEISYFSVWHGFFFSGCQMFGDEGRNEWLKTWEKSKTRGPPEQWALSLRERALGQAVQRHLHVLVCEHCWGQKNRQGHNNLLASENL,CVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKRENILITCKLYFDLILLLMCLELERVLLAIIMLQSKCGNTISNNLPWNFRVNFFFPVIMKSVIFQFGIKVSFSVAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRT

Amino Acids from 3' Exons

NVSVKTTSWPTALIIIVNASVLQLVHKILSFAQSVSKISLPVSFILTYFFNCALSWKEFYWLKSESCYKVSVGTHKFQIIFDPGTLELIFFFPSNQLFFSLALRFLFQWLPNVWRQKMAQNLGEEQNLKGPSRTMMGFMILTAMRAGSLRPSSATAPPCAGVTLLGSEEQTRTLKPALSEEP,MCLKLQAGRKLLCESSMPVYFSWCTKYCHLLKAVKYPNYLALFLNTSLIDVPVGKSFIGLNLNHVTKVWEHINFKSLTLELSFFFSRNHEISYFSVWHGFFFSGCQMFGDEGRNEWLKTWEKSKTRGPPEQWALSLRERALGQAVQRHLHVLVCEHCWGQKNRQGHNNLLASENL,CVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKRENILITCKLYFDLILLLMCLELERVLLAIIMLQSKCGNTISNNLPWNFRVNFFFPVIMKSVIFQFGIKVSFSVAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRT