McDonnell Genome Institute

Washington University

CircRNA

chr2|47046314|47060971|+|TTC7A|ENST00000319190.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9035

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

5

Peptide

IMHSLPDVHQGEAGAGAERPR

Amino Acids from 5' Exons

PDVHQGEAGAGAERPRGSPRDLQTSAEAVADPVQLLPAG,LMFTKVKLEQVLKGPEEALVTCRQVLRLWQTLYSFSQL,CSPRSWSRCKAQRKPSPADKCGCGRPCTASPSW

Amino Acids from 3' Exons

LSCSWSSSTSRKQVSASRRRRASSPLLTQYSICGAGWLRRATWRRPSSCTRRRSRTQMACASCIA,AVHGAAAPQGSRFLHPGGGGPLPHFSLSTLYAGPAGGEGQPGGGQAAVQGGAHGEPRWRAHHAP,ELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKEALTVNPDGVRIMHSL