McDonnell Genome Institute

Washington University

CircRNA

chr2|45599448|45605441|-|SRBD1|ENST00000263736.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9654

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

6

Peptide

EEVEMNWDMVQMSSLPR

Amino Acids from 5' Exons

NSSVAIADTALEDRKNKLDTVQTLKTAKTKQKCAAQPHTVRRTKKLKVEEETSKASNLEGESNSSETPSTSTVWGGTCKKEENDDDFTFGQSALKKIKTETYPQGQPVKFPANANSTKEEVEMNWDMVQ,IALWLLLILLKTEKINWILYRLKQPRQNRNVQRSHIQFEGLKSKLKKKPAKPATRVRVIVQRHHPQALCGEVHARRKRMTMTLHLVSPLRKSRLRHILRGSLSSFQQMPIVLKRRWKIGTWY,LCGYCYCFRRQKKIGYCTDSENSQDKTEMCSAATYSSKDKAESRRNQQSQQLRGEFRDTIHKHCVGRYMQEGRERLYIWSVRFKENQDDISSGAACQVSSKCQYRGGGNELGHGT

Amino Acids from 3' Exons

MSSLPRRAKVQVQDVVLKDEFSSFSE,CHHCQEERKYRSRMWYKMNFLHSLS,VIIAKKSESTGPGCGTERIFFILV