McDonnell Genome Institute

Washington University

CircRNA

chr2|45573206|45585774|-|SRBD1|ENST00000263736.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9341

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

NIHHHQVLSER

Amino Acids from 5' Exons

VPEETCLYPVISGKSILKKGKERCVSALPAFFLQHKKHSPSS,CQKRHVCIQSSLAKVSSKKVNEKDVDKFLLYQHFSCNIRNIHHHQ,ARRDMFVSSHLWQKYPQKRMRKMLISFCSTSIFPATETFTII

Amino Acids from 3' Exons

VLSERTNIEPWVCANIIRLFNDDNTIPFIIRYRKELINNLDADSLREVQQTLEEL,FYLRELILNLGFVPTSFVSLMMITQFPSLYVIEKSSLITLMLIPEKFSKPKSY,FIENYTLGLCQHHSSLHNSLHYTLKRAHPCFLERSSANPRRAT