McDonnell Genome Institute

Washington University

CircRNA

chr2|43707400|43741043|+|PLEKHH2|ENST00000282406.8

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9995

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LAALGTLR

Amino Acids from 5' Exons

KATQISSSPFLDDSSGSEEEDSSRSSSRTSESDSRSRSGPGSPRAMKR,RRPKVAALSWMTHLGQRKKTAPDPAPGRQSQTHAVGVGQAAPEPNE,GDPNKQPFPGLIWVRGRRQLQIQLPDVRVRLTQEWARQPQSHET

Amino Acids from 3' Exons

GWQLLALCVGLFLPHHPFLWLLRLHLKRNADS,AGSSWHSALGSSFPIILSCGSSGFTRGMQIP,LAALGTLRWALPSPSSFPVAPQASPKEECRFQ