McDonnell Genome Institute

Washington University

CircRNA

chr2|43498832|43556555|-|THADA|ENST00000398653.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9524

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

4

Peptide

AAILGFTSPVWADSGK

Amino Acids from 5' Exons

VHALNILRALFRDTRLGENIIPYVADGAKAAILGFTSPVWA,FMLISLEHCSEIRAWEKILFLMLLMELRLQFWVLHHRSG,SCFKYPSIVQRYAPGRKYYSLCCWSGCNSGFYITGLG

Amino Acids from 3' Exons

DSGKLQGLFQAALELSTSTKPYDCVTASYLLNFLIWQDALPSSLSAYLTQQVACDNGDRPAAVVERNTLM,IRGNCKAYFRQHWSSAQAPNHTTVQLPTCTSSGRMLYRHPCLPTLSKLHVIMEIGLLLWWKGTHW,FGETARLISGSIGAQHKHQTIRLCDSFLPAELLNLAGCSTVILVCLLNSASCMWRACCCGGKEHIN