McDonnell Genome Institute

Washington University

CircRNA

chr2|43397970|43508780|-|THADA|ENST00000398653.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9238

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

3

Peptide

QNHIHGTLLQVPK

Amino Acids from 5' Exons

VWSLTCLPLPNGSSCLGPICYDRSHSYHSNSVVHTPQLHPVFPAKPHSWDTSP,CGHSPVYHSREMAARALVPFVMIDHIPNTIRTLLSTLPSCTDQCFRQNHIHGTLLQ,VVTHLSTTPVKWQLVPWSHLLITFLIPFELCCPHSPAALTSVSGKTTFMGHFS

Amino Acids from 3' Exons

VPKCESAKAARTVAMECFRGNMQSFITLCYKAQCWNSFLHT,CPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATRRSAGIPFYIQ,AQMVCKSCQNSGYGVFRKLNAVILHLNSVLQGAVLEFLSTY