McDonnell Genome Institute

Washington University

CircRNA

chr2|40139400|40177855|-|SLC8A1|ENST00000402441.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

IFDREEYEK

Amino Acids from 5' Exons

GKMMTTMNVGKRSCPPVSITCTFLCSGRSCLPSSPLLNTGMAGRVSLSPSSLAYQLSLETWLPTLAAPLAKILLQSCSSHLEHQCQ,GRRRMWGREAALLFRLRDALSDCVLEGPVCLRPPYILEWLGVFHCLHPHDWPTDSFHWRPGFPLWLHHWPERFCDCSRVRRTWNISA,EDDDDDECGEEKLPSCFDYVMHFLTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVFVALGTSVP

Amino Acids from 3' Exons

EDHYHNIPGIERVQFLPCAGTKMDKKRNE,KIITIRIFDREEYEKECSFSLVLEEPKWIRRGMK,RSLPLEYLTVRNMRKSAVSPLCLRNQNGEEEK