McDonnell Genome Institute

Washington University

CircRNA

chr2|39260605|39288280|-|MAP4K3|ENST00000263881.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9754

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

RSIQILPLHGLQNQPK

Amino Acids from 5' Exons

HIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTES,TIFLYHVHLECLKCWFLNRSTLFVLVSVEVETSTKWFDLRRSIQILPLHGLQNQ,HRFSYTMSTNVNAGSSTGVPFSLCWCQRRLQPSGSIDGQSKFYLFMVYRI

Amino Acids from 3' Exons

PKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVAL,LSLSSYHRKCILLRMKIKEQSRDVPCQGAQQSHPKFHLDHHLPDYPHTNLLP,VYLHTTGNAFYGKSRNNQEMSHVREPSKAIPSSTTTTSQITPTQTCCL