McDonnell Genome Institute

Washington University

CircRNA

chr2|39012125|39067753|-|SOS1|ENST00000395038.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9517

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

FILLSSLMMMLFSMLK

Amino Acids from 5' Exons

VKQKNGLNPSLKSKGKKLQETMDQVIILHFRVHLPQLSGIADLGTRLLTCSPYTQKLLDNSLYLNQIYT,SNEKMGIHHNNPKEKNCKRQWTRSYYISEFTSHSVAYKQTWAHRDFPAHLTPNRNCSTTHFTIRSIP,KAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLY

Amino Acids from 3' Exons

VQGQVHPTLESNDDALQYVEELILQLLNMLCQAQPRSASDVE,SRGKFILLSSLMMMLFSMLKNFCNYICYAKLSPEVLQM,PGASSSYSRVCSSVCRINFAIIKYAMPSSAPKCFRCR