McDonnell Genome Institute

Washington University

CircRNA

chr2|37210998|37222563|-|CEBPZ|ENST00000234170.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9414

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

VQMILTLLAHFK

Amino Acids from 5' Exons

NLKSTPKSVLRKAREKVQMILTLLAHFK,TSPLQSQYEKQEKRYRFLCWLIS,LEVHSKVSTKKSKRKGTDDFDFAGSFQ

Amino Acids from 3' Exons

ESDDEENFIDANDDEDMEKFTDADKETEIVKKLETEETVPETDVETKKPEVASWVHFDNLK,SLMMKKILLMQMMMKTWKNSLMQTKKQRKNLRQRKQFLKLMKPKNQRLLPGCTLIIK,VRKFYCKRHGKIHCRQRNRDSEKTDRGNSSNCRNQKTRGCFLGALFE