McDonnell Genome Institute

Washington University

CircRNA

chr2|37049652|37060733|-|HEATR5B|ENST00000233099.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9095

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

SLPSAQDVVIVAK

Amino Acids from 5' Exons

GLAENKSTLGPEEVRKSALTLVMGPLDNPNPILRCAAGEALGRMAQVVGEATFIARMAQYSFD,ALKTKVLDLRKFVNLPHWLWVLWTTQTPSYVVQRGKLLEEWLRWLEKQLLLLEWPNIALT,LSKQKYFRTGSSICPDTGYGSSGQPKPHLTLCSGGSSWKNGSGGWRSNFYCNGPILQ

Amino Acids from 3' Exons

DHLSFVTICPRCCYCGEMFSHVPRNWKLRRPEAILLPGRLWKVVLELYV,TICRSLPSAQDVVIVAKCFPTFLKGIGSEGPRRFFYLAGNFGRSCWSSM,PSVVRYHLPKMLLLWRNVFPRSLKELEAEKARGDSFTWQVTLEGRAGALC