McDonnell Genome Institute

Washington University

CircRNA

chr2|37000585|37007304|-|HEATR5B|ENST00000233099.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.932

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

13

Peptide

STLACILEYSQPGGAFYTPETIDTAR

Amino Acids from 5' Exons

DVQSCPQFCSLQEYKTQQSLQIIRFLHQSVQLFKGLKVLHFQWPKLRLAFKNSGQLFVARLLASWNILNQ,MYDNPAHNSVLNCKNIERHSNKVCRSGSSTSQCSSSRDKYCDTFNGQNGWRSKTVDSSDSHACLHPGIFST,CMTILPTILFLIARILKDTAIKSADNQVPPPVSAALQGIKSIVTLSMAKTEAGVQKQWTALIRSTLACILEYSQP

Amino Acids from 3' Exons

VEHFIPLKLLIQLDFTIGIPGPQFSMRWHFGIAQDLRAQSLQKQQQYLVYKNVLHLSITRHQEQWVVLNLCQKLTKTECIF,WSILYPNYYSTSLSEFLGPNSPCGGTLVKHRIYVLRVYRSSSNIWFTKTFYICQFKPGIRSSGCIFARNQRQNASDF,GAFYTPETIDTARLHYRNSWAPILHAVALWLNSTGFTCSESTEAAAISGLQKRSTSVNLNQASGAVGSAKSLPEINKDRMHLIL