McDonnell Genome Institute

Washington University

CircRNA

chr2|36988645|37008848|-|HEATR5B|ENST00000233099.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9533

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

TVYVVAMNIKK

Amino Acids from 5' Exons

VQAKCYQLLLSVFQHSNRALSTPYIHSLAPIVVEKLKAVERNRPASNIELLAVQEGIKVLETLVALGEEQN,FKPNVTSFSSQSSSIPIVPFQLLIFIHLQWLKSKLLKETDQPVTSFRFKKEKFLKHWLLLVKNKT,SSQMLPASPLSLPAFQSCPFNSLYSFISSNSGKAKSCKKQTSQHRAFSGSRRNKSSNTGCSWRTK

Amino Acids from 3' Exons

VYVVAMNIKKEAESKPKRAIKNTDDDDDDCGTIDELPPDSLITLVQPELPTLSRLWLAALKDYALLTLPAEFSSQLPPD,YMWSLILKRKQSQNQKEQLKILTMMMTTVVPSMNCHQIVHWYNLNYQHSVACGQHKIMHSLYQPNFLVSFLQM,ICGRYEYKGSRVKTKKSNKYRRLWYHRTATRFNNTGTTTTNTQSPVVSSIKRLCTLDFTSRIFSASSR