McDonnell Genome Institute

Washington University

CircRNA

chr2|32758291|32787149|+|TTC27|ENST00000317907.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9951

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

DVQAEEILR

Amino Acids from 5' Exons

AEEILRQELEKKETPSLYCLLGDVLGDHSCYDKAWELSRYRSARAQRSKALLHLRNKEFQECVECFERSVKINPMQ,QKKSLDKSWRKKKRLVYTACLEMSSETILAMTRPGSCPGTAVLVLSAPKPSFIFGTRSFKSVSASNARLRLIPC,RRNPTRAGEKRNAFILLAWRCPRRPFLLQGLGVVPVPQCSCSALQSPPSSSEQGVSRVCRVLRTLGDSHA

Amino Acids from 3' Exons

SKSFNFTRSSQVLTLADLGKLHPHQHRWGIFRSHSLSPALGLTQIQRCS,VKAFRTLQEALKCNYEHWQIWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQ,KLLELYKKLSSVTMNTGRFGKTTSSPALTLGNFQKPLKLITGSWTYVTNTKMF