McDonnell Genome Institute

Washington University

CircRNA

chr2|32597750|32603083|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9601

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

LFANTFEMVSEDEDGK

Amino Acids from 5' Exons

IRLKWFLKMKMGNWDLKITTTCLRKMLMMRTVLPELAALPRKLRFQPHCLCLHPLVCLYAVMRSDLIS,YVNGFRRWEIGISKLPLHVSGEKCCEQCCQSSPPCPGSCDAFNLTASVFILCVCTLGATYHE,TFEMVSEDEDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEERLDIMK

Amino Acids from 3' Exons

VCLSILNTWHGRPEEKWNPQTSSFLQ,FVASTRGMEDQKRSGILRPQAFC,LFKHLKHVAWKTRREVESSDLKLFA