McDonnell Genome Institute

Washington University

CircRNA

chr2|32575155|32595144|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9258

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LQFVLDMARHVPLYR

Amino Acids from 5' Exons

FWTWQDMCHSIGHCWNCFGPLLLVLPWCPYCCPFLQRTVKRKKNSQNVKLLLVHCPKRPVLIPIPTV,SGHGKTCATLSGTAGIASGHCFLCCHGAPIVAPFYRERRGRRTVRMSNFCWYIVSQNEDLCYLYQPFK,LDMARHVPLYRALLELLRAIASCAAMVPLLLPLSTENGEEEEEQSECQTSVGTLLAKMKTCVDTYTNRL

Amino Acids from 3' Exons

KKNWVNTPRRRLNPNLCQYSHLKKNMWLLRNYSL,KKTGILQEGGYETQTFVSIKVTRKICGCYEEITV,KKLGEYSKKAAMKPKPLSVLKSLEEKYVAVMKKLQF