McDonnell Genome Institute

Washington University

CircRNA

chr2|32524887|32594060|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.989

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

QANQDTPSITAK

Amino Acids from 5' Exons

ILQVSQLNLVNKKMTKKRKTMKRKKKLKRKMDFKTITVLLLPL,YSKYHSINTKRQRKEKPRERKSSGKWISRQLQCCCCL,TPSITAKLISEQKDDKEKKNHEEKEKVKAENGFQDNYSVVVAS

Amino Acids from 3' Exons

IKGKCNRSKTRCVSRTRRTYSFGTRHPKDCDSLCSHHQFAASKS,SKRENVKTGVKPDASDQEPEGLTLLVPDIQKTAEIVYAATTSLRQANQ,LKGKMLKQENQMRLIKNQKDLLFWYQTSKRLLRFMQPPPVCGKQIR