McDonnell Genome Institute

Washington University

CircRNA

chr2|32499546|32515770|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.973

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

LMAQGCFPDRPR

Amino Acids from 5' Exons

GCFPDRPRTSRCPSEALRIHSGAEFSRFSYYFCRDRIGYIFSAPLYHLLRQSNVKKWIRLRGCSSMLWGTLCQSYSSGCKSSLWRNDKRSTHVFVKTCHFSAAASFRQGIQCKSVCDHKYNRCFRRKSLRRQRWQWKQYQCSRIACICCLSLSQPTNYEPDFVCSGPVQCHGNDN,GAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFLVHHYITCSDKVMSRSGSDSSVGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLVNILVQLPLSGNREYSARVSVTTNTTDSVSDEEKVSGGKDGNGSSTSVQGSPAYVADLVLANQQIMSQILSALGLCNSSAMAMII,VLSRQAKDLSMPKSSNSLWSRILKSFQLVLFLPNRLHFCTTISLAQTKCQEVDQIAPWVLEHALGDSLPILFVRVMQKQFVAKQEINSCLICNLLTFCSCLFQAIGNTVQECLPQIQQIVFQMKKKSQEAKMAMEAVPVFKDRLHMLLTSPTNKLARFCLLWACVIAVPWQL

Amino Acids from 3' Exons

VTFLVHVSSLQYGFEESCQSTLLNVSRTPKLFFFAHGLDGNYPSSSAMSSTVHDRQKAGSFIFNRLKCTSTSRINITFGYPCFLFSISSYTITRLRFAFSSCEESGFLLPHFLRKHCPVNRYFPGQTQAPSCPTTMDAYHSRPSCSYSVFDRSWQPYYERLAWWFSQSTMDSTSVFIVSLWVHFWKPFRCTTDQCKISFSFFSCYNRTDYSTAHSNECNCCVLSTVHFMPSSKADGT,LLFNWSMSLPCNMVLKKAVDSLLCSMCHVHPNYFSLLMGWMGITPPPVQCHHRLSMTDDSKKQDLSSSLTDDSKNAQAPLALTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSHISSSESIAQSIDISQDKLRRHHVPQQCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGSEVNPLWTALLFLLCHSGSTSGSHNLGAQQTSARSASLSSAATTGLTTQQRTAIENATVAFFLQCISCHPNNQKLMAQ,YFLIGPCLFPAIWFRKLLTVYFAQCVTYTQTIFLCSWAGWELPLLQCNVIIDCPQMIAKSRILVHLQMTLKMHKHLSHLNHIWLPLLPLLNLLKLLNNYTQVCLLFLGVWLVSALATFLAQKALPSQIFPRTNSGAIMSHNNVIRCLSQPTLLLFLGFQKLAIAILKIGLVVLKSIHYGQHFCFYCVTLGPLLEAIIVHNRPVQDQLLFLQLLQQDLLNSAQQLRMQLLRSFYSAFHAILIIKSWH