McDonnell Genome Institute

Washington University

CircRNA

chr2|32493539|32518946|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9552

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

VSGWSYSYTSYAR

Amino Acids from 5' Exons

VGPTATQAMQEFLTRLQVHLSSTCPQIFSEFLLKLIHILSTE,LVLQLHKLCKNFLLDYKCIFLQHVLRYSVNFCSSFIYFQLK,WSYSYTSYARISYSITSASFFNMSSDIQIFAQANSYTFNK

Amino Acids from 3' Exons

LYKGRINATSHVIQHPMYGAGHKFRTLHLPVSTTLSDVLDRVS,CTKVELMLLATSSSIQCMEQATNSVLFICQSQQHYQMFLTECQ,VQRNCYPRHPASNVWSRPQIPYSSFASLNNIIRCSQSV