McDonnell Genome Institute

Washington University

CircRNA

chr2|32441328|32445668|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9335

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

LTPMEALLQTRK

Amino Acids from 5' Exons

EKSSNVKNENTSGTRKSENLRGCDLLQEVSVTIRRFKKTSISKE,KNHLMLRMKIQVAPVNLKTSGAVIYFKRSQSPFEDLRKPQFLRK,KIICEKYKWHPIKPPGLFTSRGLSHHSKIENLNFGK

Amino Acids from 3' Exons

VLSIGILSYIMKMKIWLDAVQLVHLCLLQCPDSYRTGHQWRLYFRQ,FCLLVFCLTELCERRSGWMQYSLCIFAYCSVQTVTGQANTNGGFTSDK,SVYWYFVLLNYVKDEDLAGCSTACASLLTAVSRQLQDRLTPMEALLQT