McDonnell Genome Institute

Washington University

CircRNA

chr2|32439507|32603083|+|BIRC6|ENST00000421745.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

LFASMAGGK

Amino Acids from 5' Exons

VWQEENIVRFSMSRQMKEEQKRFVMVVCVLGFHPNTRVTRVIHLLHFWLKLQQA,YGRRKISFVFNPCQGSEKRNRRDLWWYASCSKASIPKTPEQGLFTCFTFGSCSRQ,MAGGKYRSFLIHVKAVNERGTEEICNGGMRPVVRLPSLKHQSNKGYSLASLLAKVAAGK

Amino Acids from 3' Exons

VCLSILNTWHGRPEEKWNPQTSSFLQ,FVASTRGMEDQKRSGILRPQAFC,LFKHLKHVAWKTRREVESSDLKLFA