McDonnell Genome Institute

Washington University

CircRNA

chr2|32114637|32137188|+|SPAST|ENST00000315285.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9771

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LFSESGAVPK

Amino Acids from 5' Exons

KVELFQKEKTPHTLVIHCLVQKQLKLDLQAFQATIEHLVTVVYPWFLENRDLVLLLPLI,KWSCSKKKRPLNTHFTASFKNSYENWICRPFRPPSTLQWFIHGFWSETGIWSCSYHS,SGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHK

Amino Acids from 3' Exons

VQSAGDDRVLVMGATNRPQELDEAVL,YSLLEMTEYLWVQLIGHKSLMRLFS,TVCWRQSTCNGCNATRAGCSQ