McDonnell Genome Institute

Washington University

CircRNA

chr2|29133654|29157347|+|CLIP4|ENST00000320081.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9399

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

ASAGDVETAVK

Amino Acids from 5' Exons

VMWKQLNLQLSLLTWEQTLVCGVAGQTMLCIMLLILMSLNLEFKHRNQK,CGNSCKICNSAYPGSRHFAESLDKHECFALCCLFCPTYKSDFENIETK,DVETAVKFATQLIDLGADISLRSRWTNMNALHYAAYFDVPELIRVILKTSKPK

Amino Acids from 3' Exons

LPCLDLSAAAPLHLLWNTDRATPRNRMQSAVTRRQAKALPFHPEPVL,CPAWICQQLLLYIFFGTQTELPQETECNQQQEDNEQKPFPFIQSQC,ALLGSVSSCSSTSSLEHRQSYPKKQNAISSNKKTMSKSPSLSSRASA