McDonnell Genome Institute

Washington University

CircRNA

chr2|28927568|28929710|+|WDR43|ENST00000407426.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9757

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

27

Peptide

GKEDLQTNSFPVLLTQGLESNDFEMLNVR

Amino Acids from 5' Exons

VRTPVMNSEAKVLVPGIPGHHAAIKPAPPQTEQVESKRKSGGNE,GHQILKQKFWCLGFLVIMQLSSPLLHKPSKRARGSQGEM,EDTSDEFSKSSGAWDSWSSCSYQARSSTNRASREQEEVRGK

Amino Acids from 3' Exons

VSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLN,LALKNVWEQWITHTKKERKTSRRIAFQFFLPRAKVTILKC,HRTSGSNGYRHTQKRKGRPPDELSSSSYPGLRKRFNAK