McDonnell Genome Institute

Washington University

CircRNA

chr2|28814612|28816249|+|SPDYA|ENST00000334056.9

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.922

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

LFVLPSEGK

Amino Acids from 5' Exons

SFLQKGNFGSGRGICTSLLEHQG,PSFRREISEGQEGESVPHSLNTKE,LPSEGKFLRVRKGNLYLTPTPRK

Amino Acids from 3' Exons

EYWETKMRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLF,NIGKPKGTIRCVVRHHLLSLFMNQGQIDHISLKSPLLSVLFVKIIGKHLKKIHIITTNLNAPKDLVWLYSVRILLSLNYL,ILGNQNEAQSDVLDTTYCHCLCKIRVKITSAKAHYSEASYLRLASIKKYTQQITPQRTLSGYTASGYDCFLII