McDonnell Genome Institute

Washington University

CircRNA

chr2|27827566|27858571|-|RBKS|ENST00000302188.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

QNLSQSTFPQR

Amino Acids from 5' Exons

AEILTGLTVGSAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPEPKHIPTEKVKAVDTT,LRFLASRWAALQMLGRLHCSKGAARWSLPGLKDVWCCHRQNLSQSTFPQRKSRLWIP,DFNWPHGGQRCRCWGGCISALEKGLPGGNHYLRGRMCGAVTDRTAKAHSHRESQGCGYH

Amino Acids from 3' Exons

SYFSFAKNWRNHPWTVFYWLWRERCQPVCPSCSAWSNDVHGV,LTSRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAMTSMVCK,LLLVCQKLEKPSMDISFLLALEGKVPTSVSKLLGLEQRPWCV