McDonnell Genome Institute

Washington University

CircRNA

chr2|27665099|27667390|+|SLC4A1AP|ENST00000326019.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.997

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

4

Peptide

LTEKGPEEDREAESELTVTQLK

Amino Acids from 5' Exons

GPEEDREAESELTVTQLKELRKQQQILLEKKMLGEDSDEEEEMDTSERKINAGSQDDEMGCTWGM,DQRKTERQNPSQHSRNCASSSKYCWRRRCEKTQMKKRKWIPLKGRMLVAKMMRWVAPGEW,TRGRPRGRIRVNSNTVEGIAQAAANIVGEEDARRRLRRRGNGYLKEDKCWPRDGLHLGN

Amino Acids from 3' Exons

EKMQRMMLKRTLLSSFSRKGRPFIRIPKRLSKAFLTEK,RRCSRGCREPYCLRVSAGKGGLLYKGSQKGSPRLFPR,EDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDRE