McDonnell Genome Institute

Washington University

CircRNA

chr2|27382125|27387158|-|PPM1G|ENST00000472077.1

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.988

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

DLGSPYVK

Amino Acids from 5' Exons

ECDEQPGSCRFHSIKDQPAKWGASVIVIHCGR,NVMSSQEVVDFIQSKISQRDENGELRLLSSIVEE,MAARKLISFNQRSASVMKMGSFGYCHPLWK

Amino Acids from 3' Exons

DAHNCIPELDSETAMFSVYDGHGGNFNRSYWHSRTPIPDVPGQEQVPLFIYFPGSGPHYHFLRGAVFLYSVILFSQVLYWFIISPGLVLIQRASIFFYFYFLKFLGWARGRSHLSRHSGSRGQEFETSLTNMVKPHLYKYKNLGVVVGACGPSCSEGGRRIATWEVEVAVSQDHATALQPGQQSKTLVLKNKKVYPVELILYLFFTGELSIQVRKDEIFIPERIDGEIHFFGSELPQTVSFKGSGVLRYLSPQPLGFTPVWHINIVSLSMCGEQCSRPSFLSFGRKLPCTVPNIFLISSKIRRPTRKASYRRSVCLHRPFLTCVGFSLVLPLGFSFLFVLLLLLIYSRILFLKRAYWPPFRLALLFLGLAVFICECLLVWWLTLLICIPSLCSGLYIGSSFCTSLRLFCLYSGFRRCLLGYRQIDHRSHRAGTDCRATHGRKRKSSRWVWHPLFEGKSAFEIFFNITYQFDRMAFGPGESLCRNLCSPALYVVMKRRERIIFVEWHLSCKHCIYIIFCHCDGVFLVPASIYVLFFPLKTGAVISPNSQSLSLNPNSQHCGLPGSSARIGFLQLNNKKDVRGEVLVLFLRRGNTKTKRSLWRRRSGMFFDLSERNLGSGRLWGSRLQGLLREGRIPGVWHGGSDLASSLQWTMRRLHCCMKRLPLLKSCHATGRTVTRALPTANLE,MLTTVFLSWTVRQPCFLSTMDMEVTLTDHIGNILGPQFQTFQGKNRSLCSFTFQGLALIIISCVVLFFCILSFFFPSRYCIGLSHQDLFSKEPLSFFIFIFNFAGHAVGHTCNPGTVDHEVRSSRPAPIWNPISTKNTKISWAWWAPVVPAARKAEAGESLEPGRWRLQAKTMPLHSSLGNRARLLSKTKKCTQLSFFIFFSLENVYREKTRYLYPRELMVKSIFLDQNFPKQCPSNRVQGCDIYPLNPWGSLQYGIILYHFLCVGSSAPGDLPSFPSRGGSCLVLCQISSYHQRSEGLQGRQATEGLSAYTAHSSLVAFPLFSSPWAFPFFLSSSCCCLFTLEEFCSNELIGRLLDLPYYSASELFLSVSVSCGGSHSFVFHPCAQDCIGVHFVLVLDYFAYIQALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDGECGIPCLRGNQHFKKYSLILLINSKIGWLSRDLGSPYVKETYDVLLHCMWLKGGRELSSLSGIAVSIVYTLSFVIVMGSSWFLLVFMCFFFPSRLEQLLAPIANHAILIHSSIVGFLDPQPEGFYNLTIKNETSEGKYSNCCFDEGDETQKPKEVCGGGGARACSSETARGTLGVGGCGEVRGCKGCGSERDGSHEESGMGALIPLPCSGQGGCTAARGYHDYRAADTLRAELSQGPSPQQIW,CSQLYSAGQDSHVFCLRWTWRLQIILVTFDPNSRRSRARTGPFVHLLSRVWPSLSFPAWCCFSVFCHSFFPVGTVLVYNLTRTCFNPKSLYLFLFLFFKIFRLGTRVTPVIPAQWITRSGVRDQPDQYGETPSLLKIQKLAGRSGGRLWSQLLGRLRQENRLNLGGGGCSEPRPCHCTPAWATEQDSCLKKQKSVPSADSLSFFHWRTKYTGEKRRDIYTRENWNPFFWIRTSPNSVLQIGFRGAKIFIPSTLGVHSSMAYKYCITFYVWGAVLQVTFLPFLLGEEVALYCAKYLPDIIKDQKAYKEGKLQKVCLLTPPIPHLCRLFPCSLALGLFLSFCPLAAAAYLLLKNSVPKTSLLAAFTCLIIPRPLSCFYLVSLSVVAHTLNLYSILVLRIVYREFILYSTILLIFRLKMPSWLLTPNPLKKSLKSWHRLQGDPLRMKMKKKKLMKMMVSVASLVGEISILRNILYYLSILRDGFLGTWGVLMLKKPMMFSCIVCGYEKEGENYLRVASELALYIHYLLSLWGLPGSCYLCAFFSPQDWSSYPQPIIKPKSFTVALWASWILSQNRVFTTQKMRRQRGSIVTSVVLIKKGMKHKNQKKSVEEEELGHVLLRLEREEPWEWEVVGKLEAARAVEVVRGTDPMRSLAWGLFSLFPAVDNEEAALLHEEATMTIEELLTRYGQNCHKGPPHSKSG