McDonnell Genome Institute

Washington University

CircRNA

chr2|27328036|27338020|-|GTF3C2|ENST00000264720.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

3

Peptide

TYTETVNHHYLLFQDTDLK

Amino Acids from 5' Exons

PIYKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDL,LYIKQIYRIRTVLKVQTILLLHLGSPTLLRLELTLKLSTITTCSFKTQI,YISRSDTVSGQSRSRPFFCFIWGPQPSGSNLHNCQPSLLALSRHRF

Amino Acids from 3' Exons

KQKPHCRGMAPNGLPNHIMAPVWKCLHLTKD,NRNHTAEEWLPMAYQIISWLLFGSASISPRT,TETTLPRNGSQWLTKSYHGSCLEVPPSHQGL