McDonnell Genome Institute

Washington University

CircRNA

chr2|27232447|27233140|+|CAD|ENST00000264705.8

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

81

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

SLLSTELAVR

Amino Acids from 5' Exons

HRAGCSQAASGTGDLSSSETDHSCSVASPDKLPIPNVLGHHPPHLSNTSCPSPWLWRLPYWLRILVCCRLHPAAPK,TELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRK,QSWLFASCVRNWGSVQQNRLTQLQLSGQPRQITYTRIGAPPMTSPFEHLMSSLALASTVLALALNLTGVLAASSSSE

Amino Acids from 3' Exons

MGYKTIMVNYNPETVSTDYDMCDRLYFDEISFE,WDIRPSWTITQRQSAPTMTCVIDSTLMRSLL,GIDHHGELPRDSQHRLHVSTLLDLF