McDonnell Genome Institute

Washington University

CircRNA

chr2|26792130|26793326|+|CENPA|ENST00000233505.12

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.966

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

MCNWPGGSGALR

Amino Acids from 5' Exons

ALPPINTVGGDKVGRRSESFRRAHTSGSCPSAA,RFLPSTQSAETRLAKGDPKASEEHTPLDKEAALQPP,ASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRL

Amino Acids from 3' Exons

AAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLGAPAPSVSVSLSCSAR,QQKHFFISLRTPISSPYMQAELLSSQRMCNWPGGSGALRRDSAELLHPVFLSVFPAQPG,SRSISSSSLGRLSPHLTCRPSYSLPKGCATGPEDPGPGGTRLSSCTQCFCQSFLLSQG