McDonnell Genome Institute

Washington University

CircRNA

chr2|25282440|25282711|-|DNMT3A|ENST00000264709.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9659

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

GAPAEAGGK

Amino Acids from 5' Exons

VESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEA,WKAVTRQRTLRSPSPHPWPRTQAPQSYYPMGTWRSGVSPSQRRGALLGGRRAGPQQRERVQLRPCLKPQEQWKMAAAPPRRAEEPLQKR,GKRHAKGPCGDLQVPIHGPGLRRLRAITQWGLGEAEAPARGGEPCWGAEGRGPSRGRGCSDPASLKSSGKWLLHPQGGPRSPCRS

Amino Acids from 3' Exons

VESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEA,WKAVTRQRTLRSPSPHPWPRTQAPQSYYPMGTWRSGVSPSQRRGALLGGRRAGPQQRERVQLRPCLKPQEQWKMAAAPPRRAEEPLQKR,GKRHAKGPCGDLQVPIHGPGLRRLRAITQWGLGEAEAPARGGEPCWGAEGRGPSRGRGCSDPASLKSSGKWLLHPQGGPRSPCRS