McDonnell Genome Institute

Washington University

CircRNA

chr2|25244154|25246309|-|DNMT3A|ENST00000264709.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9899

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

LQMFFANNHDQEFK

Amino Acids from 5' Exons

VLLRGVCGPLGGAGGCPGSHGRPLELLHVRAQGYLRAAAAARGLALPAPDVLRPRPGI,CFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEF,AFAWSVWTSWWGRGLPRQPLRKTPGTATCAGTRVPTGCCGGERTGPPGSRCSSLITTTRN

Amino Acids from 3' Exons

KRRIPTKKCTRTCGWNLRQLPTHHLHQPKSPGRAQRRSPRSRRLLMSAQE,REESLQRSVHGHVGGTGSCLRTTSTSQKAPEEHSGEAQGQGDYAHK,EKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTR