McDonnell Genome Institute

Washington University

CircRNA

chr2|24836916|24838622|-|ADCY3|ENST00000260600.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

SPTGVPTAVGPR

Amino Acids from 5' Exons

ALPNGAPASSKSSSPALIETKEPNGSAHSSGSTSEKPEEQDAQ,PCPMEHQLPQSPAPLPSLRPRSPTGVPTAVGPRRRSPRSRMP,PAQWSTSFLKVQLPCPHDQGAQRECPQQWVHVGEARGAGCP

Amino Acids from 3' Exons

ARAHLPEHHGLPERGVCGARRWGQPLLPRREGYNLPHHCLQARGEENSHPEWPQWL,RVHISQSTMDCLKGEFDVEPGDGGSRCDYLEEKGIETYLIIASKPEVKKTATQNGLNGS,ACTSPRAPWTAKGSLMWSQAMGAAAVITKRRVLKPTSSLPPSQRRKQPPRMASMA